Protein coding transcript 36793

• Transcript: Ll_transcript_384067
• CDS coordinates: 139-1338 (+)
• Peptide sequence: MTTFIRRIGLSYIFLTFFLSLGIGFFECVASFGINYGQVANNLPPPEKVLELFSYFKITKTRIYDTNPEILNAFANSNIEVIVTIENGMLSQLSDPQQALQWVSDHIKPYLPDTKITGIQVGNEIFSDGDISLIQSLVPALVNIHNALAQLGIGSNIQVSTPCSLSVLEQSYPPSAGSFKSEISDIMHQFLDFLSSTKAPFWINAYPYFAYKDAPNEISLDYVLFNPSVGMVDPNTKLHYDNMLYAQVDAVIFAIANMGFNGIEVRVSETGWPSKGDSDEAGATMQNAATYNKNLLRRQIANEGTPLRPRMRLEAYLFALFNEDMKPGPTSERNYGLFEPDESMTYNVGLSAFATTSASSTSISLTSSATNTKAAPKGYQTLFYWILLYVLTSTLRGSL*
• ORF Type: complete

Annotations of Ll_transcript_384067

• Blastp: Glucan endo-1,3-beta-glucosidase 14 from Arabidopsis with 50.29% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 14 from Arabidopsis with 52.04% of identity
• Eggnog: glucan endo-1-3-beta-glucosidase(ENOG410YA4N)
• Kegg: Link to kegg annotations (AT2G27500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445850.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;