| Transcript | Ll_transcript_317853 |
|---|---|
| CDS coordinates | 1-354 (+) |
| Peptide sequence | LAASLPAVRFLARPENLTSITMVHHVVDMDDLKAKLTEAGGNLVVIDFFATWCAPCKQIAPRLEELSKEHPEVTFLKVDVDECEEIATEYKIDVMPTFIFIKNNEIAFNFSVARYETL |
| ORF Type | internal |
| Blastp | Thioredoxin-2 from Sophophora with 54.08% of identity |
|---|---|
| Blastx | Thioredoxin-2 from Sophophora with 54.08% of identity |
| Eggnog | Thioredoxin(COG0526) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014499716.1) |
| Pfam | AhpC/TSA family (PF00578.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer