Transcript | Ll_transcript_385523 |
---|---|
CDS coordinates | 105-467 (+) |
Peptide sequence | MSNAFNVSDLTAALNEENRADIVNALKSKIQSLAGQHSDILESLSPIVRKRVEFLREIQGQHDEIEAKFFEERAALEAKYQKLYQPLYTKVSQVTYDFISYVCICCNSYIELCASCSKLFS |
ORF Type | 3prime_partial |
Blastp | Nucleosome assembly protein 1;2 from Arabidopsis with 74.23% of identity |
---|---|
Blastx | Nucleosome assembly protein 1;2 from Arabidopsis with 77.42% of identity |
Eggnog | nucleosome assembly(ENOG410XQN9) |
Kegg | Link to kegg annotations (AT2G19480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454957.1) |
Pfam | Nucleosome assembly protein (NAP) (PF00956.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer