Protein coding transcript 36966

• Transcript: Ll_transcript_385523
• CDS coordinates: 105-467 (+)
• Peptide sequence: MSNAFNVSDLTAALNEENRADIVNALKSKIQSLAGQHSDILESLSPIVRKRVEFLREIQGQHDEIEAKFFEERAALEAKYQKLYQPLYTKVSQVTYDFISYVCICCNSYIELCASCSKLFS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_385523

• Blastp: Nucleosome assembly protein 1;2 from Arabidopsis with 74.23% of identity
• Blastx: Nucleosome assembly protein 1;2 from Arabidopsis with 77.42% of identity
• Eggnog: nucleosome assembly(ENOG410XQN9)
• Kegg: Link to kegg annotations (AT2G19480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454957.1)
• Pfam: Nucleosome assembly protein (NAP) (PF00956.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;