| Transcript | Ll_transcript_385579 |
|---|---|
| CDS coordinates | 117-440 (+) |
| Peptide sequence | MASIYASLLIHFILLVLVSCKTMALLKLPQNVTVPAVFVFGDSTVDTGNNNNNMQTSARCNFPPYGKNLRGGIPTGRFSNGKVPSDIIGTPLLFLFLVLLVLYMSGN* |
| ORF Type | complete |
| Blastp | GDSL esterase/lipase EXL1 from Arabidopsis with 53.85% of identity |
|---|---|
| Blastx | GDSL esterase/lipase EXL1 from Arabidopsis with 52.69% of identity |
| Eggnog | GDSL esterase lipase(COG3240) |
| Kegg | Link to kegg annotations (AT1G75880) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449471.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer