Protein coding transcript 36987

• Transcript: Ll_transcript_385282
• CDS coordinates: 1723-2178 (+)
• Peptide sequence: MEKVNLRSSSTKAKIMGSITSIAGAFVVVLYKGPTILNAASPSQPPSLDSPLGSSQRNWILGGFLLTVAYILMSIWYILLTHVIKLYPSEFIVTFLCNFCATIIAAPVCFLAEANLGAWKLKPDITLVAVIYSVSITNLCIFCNKYVNEVL*
• ORF Type: complete

Annotations of Ll_transcript_385282

• Blastp: WAT1-related protein At5g40240 from Arabidopsis with 53.68% of identity
• Blastx: WAT1-related protein At5g40240 from Arabidopsis with 56.32% of identity
• Eggnog: EamA-like transporter family(ENOG4111BCK)
• Kegg: Link to kegg annotations (AT5G40240)
• CantataDB: Link to cantataDB annotations (CNT0001375)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433718.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;