Protein coding transcript 36998

• Transcript: Ll_transcript_385313
• CDS coordinates: 2-589 (+)
• Peptide sequence: RSSSPQQLNAVERAVQVLERLGGVPNPRTFVGVDFFSVFQEVYLRSNDPRVCNIVSFSDAIGELKVEAAASIEDGKRILFRFDRAAFSFKFLPFKVPYPVPFKLLGDEAKGWLDTTYLSHSGNLRISRGNKGTTFVLQKQTEPRQRLLTAVSSGKGVKEAIDEFISSNRTTGDEDPELKEGEWEMIWNSQTTTDSW
• ORF Type: internal

Annotations of Ll_transcript_385313

• Blastp: Probable plastid-lipid-associated protein 12, chloroplastic from Arabidopsis with 65.32% of identity
• Blastx: Probable plastid-lipid-associated protein 12, chloroplastic from Arabidopsis with 65.32% of identity
• Eggnog: plastid-lipid-associated protein 12(ENOG410YI3F)
• Kegg: Link to kegg annotations (AT1G51110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428988.1)
• Pfam: PAP_fibrillin (PF04755.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;