Transcript | Ll_transcript_385315 |
---|---|
CDS coordinates | 1659-1991 (+) |
Peptide sequence | MIWNSQTTTDSWIENAANGLMGKQIIGKGGRIKYLVDILLGLKFSMTGSFVKTGSKTFDITMDDAAIIGGPFGYPVELKNKFSLELLYSDEKIRITRGYNKILFVHTRTG* |
ORF Type | complete |
Blastp | Probable plastid-lipid-associated protein 12, chloroplastic from Arabidopsis with 62.96% of identity |
---|---|
Blastx | Probable plastid-lipid-associated protein 12, chloroplastic from Arabidopsis with 58.96% of identity |
Eggnog | plastid-lipid-associated protein 12(ENOG410YI3F) |
Kegg | Link to kegg annotations (AT1G51110) |
CantataDB | Link to cantataDB annotations (CNT0002381) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428987.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer