Transcript | Ll_transcript_427703 |
---|---|
CDS coordinates | 226-561 (+) |
Peptide sequence | MGNVDAALKTSLLWLAALILVVGLCTHSMKKMMVTYVMGVVGISGVLLPDWDYFNRDFSRWGYPITAEERASHLAQGSGFLRFAYSPLRVIAYCVIYGYAMYKWWKYVTSS* |
ORF Type | complete |
Blastp | Signal peptidase complex-like protein DTM1 from Oryza sativa with 41.67% of identity |
---|---|
Blastx | Signal peptidase complex-like protein DTM1 from Oryza sativa with 41.67% of identity |
Eggnog | Microsomal signal peptidase 12 kDa subunit (SPC12)(ENOG410YTII) |
Kegg | Link to kegg annotations (4343951) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438530.1) |
Pfam | Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer