Protein coding transcript 37018

• Transcript: Ll_transcript_384666
• CDS coordinates: 420-806 (+)
• Peptide sequence: MIELGEGTNTLKLECSCKGELSFAHRECAVKWFSIKGNRICDVCKQEVQNLPVTLLRIQTVRGHRDQEDEISQHRFWQDGSILIIVNTLAYFCFLEQLLVFLQAWQLEQWVWLILLFDNTVLEFILQYH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_384666

• Blastp: Probable E3 ubiquitin ligase SUD1 from Arabidopsis with 34.69% of identity
• Blastx: Probable E3 ubiquitin ligase SUD1 from Arabidopsis with 37.93% of identity
• Eggnog: (Membrane-Associated Ring finger (C3HC4))(COG5183)
• Kegg: Link to kegg annotations (AT4G34100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432271.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;