Protein coding transcript 37025

• Transcript: Ll_transcript_384695
• CDS coordinates: 651-1247 (+)
• Peptide sequence: MNLPIHRSHSVPDFTRDDNVGCMFGMVSTTPRLAEKTVTRTTPTSIPDDTVENEDGGEDIPEEEAVCRICMIELGEGTNTLKLECSCKGELSFAHRECAVKWFSIKGNRICDVCKQEVQNLPVTLLRIQTVRGHRDQEDEISQHRFWQDGSILIIVNTLAYFCFLEQLLVFLQAWQLEQWVWLILLFDNTVLEFILQYH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_384695

• Blastp: E3 ubiquitin-protein ligase MARCH7 from Rattus with 28.28% of identity
• Blastx: E3 ubiquitin-protein ligase MARCH7 from Rattus with 29.29% of identity
• Eggnog: (Membrane-Associated Ring finger (C3HC4))(COG5183)
• Kegg: Link to kegg annotations (311059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432271.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;