Transcript | Ll_transcript_384702 |
---|---|
CDS coordinates | 651-1370 (+) |
Peptide sequence | MNLPIHRSHSVPDFTRDDNVGCMFGMVSTTPRLAEKTVTRTTPTSIPDDTVENEDGGEDIPEEEAVCRICMIELGEGTNTLKLECSCKGELSFAHRECAVKWFSIKGNRICDVCKQEVQNLPVTLLRIQTVRGHRDQEDEISQHRFWQDGSILIIVNTLAYFCFLEQLLVSKMGSSVVVMPLPFSCILGLLASVAARTMVRRKDVCVYATVQFALVVLAGQIFYSLVSSFCSRSCSVLC* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase MARCH7 from Rattus with 29.17% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase MARCH7 from Rattus with 29.17% of identity |
Eggnog | (Membrane-Associated Ring finger (C3HC4))(COG5183) |
Kegg | Link to kegg annotations (311059) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432271.1) |
Pfam | RING-variant domain (PF12906.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer