Protein coding transcript 37096

• Transcript: Ll_transcript_385554
• CDS coordinates: 32-676 (+)
• Peptide sequence: MFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQELVAKDLHGLEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELRLGIRRAAQLKSGTFAVPSSQQLNPSTLMDVVNALSARCAFSVCYNPRVSSSEFIIPLHKFSKSLDCSYSVGMRFRLRFETEDAAERRFVNCHAFPCFIQIADQSLSWSNFFCADSQD*
• ORF Type: complete

Annotations of Ll_transcript_385554

• Blastp: Auxin response factor 2 from Oryza sativa with 32.11% of identity
• Blastx: Auxin response factor 15 from Oryza sativa with 74.21% of identity
• Eggnog: auxin response factor(ENOG410YC80)
• Kegg: Link to kegg annotations (4325895)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440226.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;