Protein coding transcript 37112

• Transcript: Ll_transcript_384599
• CDS coordinates: 132-863 (+)
• Peptide sequence: MTVATATLQAKRIFKLTLNLLRLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIAMLLQSGQDATARIRVEHVMREQNVLAANEFIELFCELVVARLSIISKQRECPADLKEGIASIVFASSRCSEIPELVSLKKIFEKKYGKDFVSAATDLRPSCGVNRQLIEKLSVRTPPGEVKLKVMKDIAKEYQIDWDTAESEKELLMPPEELIQGPRAFVSASSLPLKPSNAVSMESNKATTR*
• ORF Type: complete

Annotations of Ll_transcript_384599

• Blastp: IST1-like protein from Dictyostelium with 34.74% of identity
• Blastx: IST1-like protein from Dictyostelium with 34.74% of identity
• Eggnog: positive regulation of collateral sprouting(ENOG410YG52)
• Kegg: Link to kegg annotations (DDB_G0289029)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446899.1)
• Pfam: Regulator of Vps4 activity in the MVB pathway (PF03398.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;