Protein coding transcript 37113

• Transcript: Ll_transcript_384600
• CDS coordinates: 132-494 (+)
• Peptide sequence: MTVATATLQAKRIFKLTLNLLRLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIAMLLQSGQDATARIRVEHVMREQNVLAANEFIELFCELVVARLSIISKQRLSIEKFRFFSL*
• ORF Type: complete

Annotations of Ll_transcript_384600

• Blastp: IST1 homolog from Pongo with 35.56% of identity
• Blastx: IST1-like protein from Dictyostelium with 38.55% of identity
• Eggnog: positive regulation of collateral sprouting(ENOG410YG52)
• Kegg: Link to kegg annotations (100173540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446899.1)
• Pfam: Regulator of Vps4 activity in the MVB pathway (PF03398.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;