Protein coding transcript 37144

• Transcript: Ll_transcript_384963
• CDS coordinates: 460-1293 (+)
• Peptide sequence: MGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLRENEHMVIVIAEGAGQDLFTEHMRDMSQKDASGNKLLQDVGLWISHRIKDYFARTNKMSITLKYIDPTYMVRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTYIPFSRIIERQNKVVITDRMWARLLSSTNQPSFLNLKDIEDANKPEQPPTQLLEGKKCENLDEVRSETPSQVLEEDNSKEESGNKAENLDEVRSETPSQLLEEDNSKEESGNDPDQSMET*
• ORF Type: complete

Annotations of Ll_transcript_384963

• Blastp: ATP-dependent 6-phosphofructokinase 6 from Arabidopsis with 84.9% of identity
• Blastx: ATP-dependent 6-phosphofructokinase 3 from Arabidopsis with 69.52% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (AT4G32840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438445.1)
• Pfam: Phosphofructokinase (PF00365.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;