Protein coding transcript 37145

• Transcript: Ll_transcript_384968
• CDS coordinates: 1171-1533 (+)
• Peptide sequence: MAITLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFNVNYSLHKLRISVFMLYFMWLQFANNECKRYICYNHGQERMILRIIERQNQVVITDRMWARL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_384968

• Blastp: ATP-dependent 6-phosphofructokinase 6 from Arabidopsis with 58.68% of identity
• Blastx: ATP-dependent 6-phosphofructokinase 7 from Arabidopsis with 58.91% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (AT4G32840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415576.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;