Protein coding transcript 37179

• Transcript: Ll_transcript_384090
• CDS coordinates: 1386-1868 (+)
• Peptide sequence: MYLAAIADSQPQPPVMSGQYPSTGMMQQGGHYMQAPQMTQQQLMAARSSLLYSQQQPYATLQQQQQQQQGIHSQLAMSSGGASSGHHLLQSEGSNVGGGIGPAGIPDFIRSSAGEGLQLHGGRGMIGSSKQDIGSSGERGGSSGEGGESLYLKSAVDDGN*
• ORF Type: complete

Annotations of Ll_transcript_384090

• Blastp: GRF1-interacting factor 1 from Arabidopsis with 46.89% of identity
• Blastx: GRF1-interacting factor 1 from Arabidopsis with 60.27% of identity
• Eggnog: synovial sarcoma translocation gene on chromosome 18-like(ENOG41128HA)
• Kegg: Link to kegg annotations (AT5G28640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418135.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;