Transcript | Ll_transcript_385349 |
---|---|
CDS coordinates | 461-1237 (+) |
Peptide sequence | MKKISPSKSATSDVIKGSIEWELKPGGMLVQKRQQPLESCASPVINIMVSHGSYYHGHVKSVLTSETGLEPKEQRLLFKGKEKEHEECLHMVGAKHMSNIVLFEDPASKERKLEEMQKSEEYILKACEAISIIKSEVDKLYQKVLTLETTICGGTKVEEKEFAMLTELLMVQLLKLDSIVANGEAKIQRRVEVGRVQSYVETIDNLKARNSAAFSNAANNEVSVITKWKAFDSGVESLKSPTPFQLSTVITQDWELFE* |
ORF Type | complete |
Blastp | BAG family molecular chaperone regulator 4 from Arabidopsis with 40.46% of identity |
---|---|
Blastx | BAG family molecular chaperone regulator 4 from Arabidopsis with 40.46% of identity |
Eggnog | BCL-2-associated athanogene(ENOG4111WNH) |
Kegg | Link to kegg annotations (AT3G51780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460291.1) |
Pfam | BAG domain (PF02179.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer