Protein coding transcript 37379

• Transcript: Ll_transcript_383642
• CDS coordinates: 156-860 (+)
• Peptide sequence: MGEMSSFQMGVVGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLIVTFCTLHVAQRLNLFVSKSIDMKTVMLFGILNGVSIGFLNLSLGFNSIGFYQMTKLAIIPFTVLLETIFLKKQFSQKIKLSLFLLLVGVGIASITDLQLNLVGSILSLLAILTTCVGQILTNTIQKKLNVSSTQLLYQSAPFQAAILFVSGPVVDQLLTKQSVFAHKYSPVVLVILNPYYAQRF*
• ORF Type: complete

Annotations of Ll_transcript_383642

• Blastp: UDP-xylose transporter 1 from Arabidopsis with 83.41% of identity
• Blastx: UDP-xylose transporter 1 from Arabidopsis with 83.41% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457290.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;