Transcript | Ll_transcript_383801 |
---|---|
CDS coordinates | 2-400 (+) |
Peptide sequence | SPSVLIPALRTVGNIVTGDDMQTQSIINHGALPSLLSLLTHNHKKSIKKEACWAISNITAGNKEQIQSVIGSGLIGPLVILLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCELLICPDPRII |
ORF Type | internal |
Blastp | Importin subunit alpha-1 from Arabidopsis with 84.21% of identity |
---|---|
Blastx | Importin subunit alpha-1 from Arabidopsis with 84.21% of identity |
Eggnog | importin subunit alpha(COG5064) |
Kegg | Link to kegg annotations (AT3G06720) |
CantataDB | Link to cantataDB annotations (CNT0000957) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464362.1) |
Pfam | Armadillo/beta-catenin-like repeat (PF00514.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer