Protein coding transcript 37445

• Transcript: Ll_transcript_383811
• CDS coordinates: 264-767 (+)
• Peptide sequence: MVSNAQEELLQWHAENAKDNPKILHASERCASGIIQAIGHFNLGPNLSPRDIPDHENNVINPLPGHEIVNFNLLVEKWRRAEVEKSDLFITGLEALTVCLISFYFYRLPIMCLFYLCSHSAGYLKCSPKCCLLPNNSFLCVKYSYLFPHIICIFMFYEVVLRFTNRK*
• ORF Type: complete

Annotations of Ll_transcript_383811

• Blastp: Probable sucrose-phosphatase 2 from Arabidopsis with 68.75% of identity
• Blastx: Probable sucrose-phosphatase 2 from Arabidopsis with 74.38% of identity
• Eggnog: ,hydrolase(COG0561)
• Kegg: Link to kegg annotations (AT2G35840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428612.1)
• Pfam: Sucrose-6F-phosphate phosphohydrolase (PF05116.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;