Protein coding transcript 37502

• Transcript: Ll_transcript_383590
• CDS coordinates: 861-1190 (+)
• Peptide sequence: MIQGGDFTEGDGTGGTSIYGARFKDESFALKHIGFGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVKTLEFQETSRLDIPRKPCRIVNCGELTNED*
• ORF Type: complete

Annotations of Ll_transcript_383590

• Blastp: Peptidyl-prolyl cis-trans isomerase, chloroplastic from Vicia with 80.19% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic from Arabidopsis with 78.95% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440650.1)
• Pfam: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;