Transcript | Ll_transcript_383590 |
---|---|
CDS coordinates | 861-1190 (+) |
Peptide sequence | MIQGGDFTEGDGTGGTSIYGARFKDESFALKHIGFGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVKTLEFQETSRLDIPRKPCRIVNCGELTNED* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase, chloroplastic from Vicia with 80.19% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic from Arabidopsis with 78.95% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440650.1) |
Pfam | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer