Protein coding transcript 3760

• Transcript: Ll_transcript_417189
• CDS coordinates: 166-900 (+)
• Peptide sequence: MATITILTLLFFFFTLSLALDMSIITYPHNHNQPNPRSNDEVRTMYEEWLVKHQKVYNGLGEKDKRFQVFKDNLVFIDEHNAQNNTYKLGLNKFADLTNEEYRAMYLGTRNDHKRRVMNAKKSGHRYAYEARDRLPVHVDWRLKGAVAPIKDQGGCGSCWAFSTVGAVEGINKIVTGKLVSLSEQELIDCDRIYDEGCNGGLMDYAFEFIISNGGLDTEQDYPYKATDSICDPTRVSILTFPIL*
• ORF Type: complete

Annotations of Ll_transcript_417189

• Blastp: Probable cysteine protease RD21B from Arabidopsis with 61.34% of identity
• Blastx: Probable cysteine protease RD21B from Arabidopsis with 64% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT5G43060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446808.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;