Protein coding transcript 37648

• Transcript: Ll_transcript_384652
• CDS coordinates: 94-1437 (+)
• Peptide sequence: MTSKLVFSTLRHHLRRQPFSTAAAVAESQYHEDSAGITMKGVKISGRPLYLDVQATSPVDPRVLDAMLPFYLSRYGNPHSRTHFYGWESDNAVEHSRAQVASLIRASPKEIVFTSGATESNNISIKGVMHFYKDKKRHVITTQTEHKCVLDSCRYLQQEGFDVTYLPVESDGLVDLEKLRAAIRPDTGLVSVMAVNNEIGVVQPLEEIGKICKEFNVPFHTDAAQALGKIPIDVEKWNVSLMSLSGHKVYGPKGVGALYMRRRPRIRVEPQMNGGGQERGIRSGTVPTPLVVGMGAACEVSMKEMEYDEKRISALQERLLNGIREKLDGVVVNGSMERRYAGNLNLSFAYVEGESLLMGLKEVAVSSGSACTSASLEPSYVLRALGVEEDMAHTSIRFGIGRFTTEAEIDRAIELTVHQVEKLREMSPLYEMVKEGIDISKIQWSQH*
• ORF Type: complete

Annotations of Ll_transcript_384652

• Blastp: Cysteine desulfurase, mitochondrial from Arabidopsis with 77.8% of identity
• Blastx: Cysteine desulfurase, mitochondrial from Arabidopsis with 77.8% of identity
• Eggnog: cysteine desulfurase(COG1104)
• Kegg: Link to kegg annotations (AT5G65720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423755.1)
• Pfam: Aminotransferase class-V (PF00266.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;