Protein coding transcript 37664

• Transcript: Ll_transcript_385167
• CDS coordinates: 2-646 (+)
• Peptide sequence: VFYKGRAPKGEKSNWVMHEYRLDGENSMNNLSKSSKEDWAVYRVFQKISFAKRMHLPMLSELSPVNDSPPPPPYKSVKKNAIGESSYVTNVSTFSGPNQTDEDMKTKNNDIIVDSFETPPMLPPPPSYSPYPSDIFPSTWDFTNTTLPTPFANNHVGNDAQYSDDGYFMNQDESVMNMLIEDHGSTTMHNNNNNNNNNSSNNNNDSNNNNDSNNN
• ORF Type: internal

Annotations of Ll_transcript_385167

• Blastp: NAC domain-containing protein 79 from Arabidopsis with 49.37% of identity
• Blastx: NAC domain-containing protein 79 from Arabidopsis with 49.35% of identity
• Eggnog: NAC domain-containing protein(ENOG410Y9QZ)
• Kegg: Link to kegg annotations (AT5G07680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442676.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;