Protein coding transcript 37672

• Transcript: Ll_transcript_384853
• CDS coordinates: 1630-1956 (+)
• Peptide sequence: MDGFLQDFFPSVYEHRKHTHQNHYCNYDNHGLAAFTSSLYIAGLVASLLASVVTRKYGRRTSSISGGISFLIGSALNASALNLEMLIIGRIMLGVGIGFGNQVLIFFP*
• ORF Type: complete

Annotations of Ll_transcript_384853

• Blastp: Sugar carrier protein A from Ricinus with 70.19% of identity
• Blastx: Sugar transport protein 7 from Arabidopsis with 68.47% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8262851)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003546610.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;