Protein coding transcript 37675

• Transcript: Ll_transcript_384857
• CDS coordinates: 1630-2643 (+)
• Peptide sequence: MDGFLQDFFPSVYEHRKHTHQNHYCNYDNHGLAAFTSSLYIAGLVASLLASVVTRKYGRRTSSISGGISFLIGSALNASALNLEMLIIGRIMLGVGIGFGNQAVPLYLSEMAPTHLRGGLNMMFQVAATFGIFTANMINYGAQRIKPWGWRLSLGMAAIPAILMTVGGIFLPDTPNSLVRRGSKVKGRKLLEKIRGTNDVDAEFQDMVDASDYANTIKQPFRNIFGKRYRPQLTMAICMPAFQILTGISSILFYAPLLFQSMGFGRAASLYSSALTGGVLALSTFISIATVDKLGRRPLLISGGIQMVTCQVNSLWILNVYKNRHWEIMLQSEQIHH*
• ORF Type: complete

Annotations of Ll_transcript_384857

• Blastp: Sugar transport protein 7 from Arabidopsis with 73.12% of identity
• Blastx: Sugar transport protein 7 from Arabidopsis with 73.09% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT4G02050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464602.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;