Transcript | Ll_transcript_520033 |
---|---|
CDS coordinates | 36-620 (+) |
Peptide sequence | MNKMQKQENEGEGKEVRNNENERDEGKKENPAPLKALNHVSRLCRNVKKSIEFYTKVLGFVLMERPQVLDFEGAWLFNYGIGIHLVQSKEEERLPSHTKELEPNDNHICFQCEEVEEMERKLKEMDIKYMKRSLKSEDGTAMDQIFFNDPDGFMVEICNCEDFKLVPVESLGKLKLPMDRHIPPIQTNHHHASN* |
ORF Type | complete |
Blastp | Lactoylglutathione lyase from Rattus with 26.57% of identity |
---|---|
Blastx | - |
Eggnog | Lactoylglutathione lyase(ENOG4111FDV) |
Kegg | Link to kegg annotations (294320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439308.1) |
Pfam | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer