Transcript | Ll_transcript_384735 |
---|---|
CDS coordinates | 274-858 (+) |
Peptide sequence | MVNPKLSTRPKICYRPIRPSDFEILEHIHVKLFPIRYESTFFQDVVNGRDIVSWGAVDSSRPDGQSDELIGFVTARIVLAKESEIVDMLGYDSSKSDQTLVYILTLGVVDSYRNHGIASSLIRQVIKYASSIPTCRAVYLHVISYNNPAIYLYKKMSFKCIRRLQGFYLINDQQYDSYLFLYYVNGGRSPCSPL* |
ORF Type | complete |
Blastp | Histone acetyltransferase MCC1 from Arabidopsis with 64.43% of identity |
---|---|
Blastx | Histone acetyltransferase MCC1 from Arabidopsis with 64.62% of identity |
Eggnog | N(alpha)-acetyltransferase 60, NatF catalytic subunit(ENOG410Y94A) |
Kegg | Link to kegg annotations (AT3G02980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454346.1) |
Pfam | Acetyltransferase (GNAT) family (PF00583.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer