Protein coding transcript 37833

• Transcript: Ll_transcript_385131
• CDS coordinates: 3-887 (+)
• Peptide sequence: QLSLEFSTTLIRFLSFLSSHFEVALTLIVMPSNSPKTDDDFEWNADTMLRIYLHDYLLKRGFHHTAQTFKEEGDIVKDSVAIDSPVGFLYEWWCLVYDVYKCRTVKDPNSVPESSSSNTYNARNSNSFPMIPQIPMSQLRYLPHQFQASSSSSLIPPQPAADLIPSILYSRERVRAELMALAEACNMKFLPWDPSRPPLLRVRKKIQKQVIKDSRIGIHLGKDVPRDPMQLVQPAESSNRDKKMTDQVIKTAENQNQPSQQSQNVKVWYSIFQISKLFQFTLWVIENKLLCIYF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_385131

• Blastp: Transcriptional corepressor LEUNIG from Arabidopsis with 48.61% of identity
• Blastx: Transcriptional corepressor LEUNIG from Arabidopsis with 48.61% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G32551)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418350.1)
• Pfam: LisH (PF08513.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;