| Transcript | Ll_transcript_385109 |
|---|---|
| CDS coordinates | 521-841 (+) |
| Peptide sequence | MHFLVPFKRQFFVLLADMSDNSIITLLTLFLSQLNYVVNTIFSLNMVIAFLVAIVLDNTVPGSKQERGVYVWSEPEVARMEPAVAKDYELPLRVGRIFRWVKWVGM* |
| ORF Type | complete |
| Blastp | Nucleobase-ascorbate transporter 12 from Arabidopsis with 66.67% of identity |
|---|---|
| Blastx | Nucleobase-ascorbate transporter 12 from Arabidopsis with 66.67% of identity |
| Eggnog | permease(COG2233) |
| Kegg | Link to kegg annotations (AT2G27810) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458404.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer