Protein coding transcript 37848

• Transcript: Ll_transcript_385112
• CDS coordinates: 818-1171 (+)
• Peptide sequence: MVVSTVLFISGVTTLLHTTFGSRLPLVQGPSFVYLAPVLAIINSPEFQGLNQNKFKHTMKELQGAIIIGSAFQALLGYTGLMSLLVRYDYGIFSACLFGFITSMHIIVSTNNAHVVN*
• ORF Type: complete

Annotations of Ll_transcript_385112

• Blastp: Nucleobase-ascorbate transporter 12 from Arabidopsis with 53.27% of identity
• Blastx: Nucleobase-ascorbate transporter 12 from Arabidopsis with 55.84% of identity
• Eggnog: permease(COG2233)
• Kegg: Link to kegg annotations (AT2G27810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458402.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;