Protein coding transcript 3788

• Transcript: Ll_transcript_417081
• CDS coordinates: 2-493 (+)
• Peptide sequence: PLLPLRLLTSQLRNNSFTYQHTLKLTAIMSSGGNTVNVKGISHETTEKEVRDFFSFCGKISDLTLTPKSQDETSKSYAVSFEKPTAAKTALLLDNTQLGSNHVNVTAASDLDAIAPGKTAGHSEGDSPEDIAQEDKPRSRIFAEYLAHGYVLTDNAIEKAIALD
• ORF Type: internal

Annotations of Ll_transcript_417081

• Blastp: Protein vip1 from Schizosaccharomyces with 44.27% of identity
• Blastx: Protein vip1 from Schizosaccharomyces with 44.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC10F6.06)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004509746.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;