Protein coding transcript 37937

• Transcript: Ll_transcript_499865
• CDS coordinates: 378-1193 (+)
• Peptide sequence: MWNDVPQNEENLSYIFDDVTTPVKACDFAYNVNHNDLDDMQKELEECREGSQVKRRRMLQFNSQDSDHSLSSEEFSSAYIKLNEKEDNSMKDVFPEVSQWMSETPGNASASGYEDLVSTEGWLAECFNDAEMQFSPEDLNIAAAEGVQFNVAGLSNSTPSCEQNLVQKQVTRTRGNIIFRGRKSFIRTPTKLASSVAYPFAFIKPSGAHGDVTLKEINQRIRTPPPSTSNQSSDDPSLYPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG*
• ORF Type: complete

Annotations of Ll_transcript_499865

• Blastp: Protein XRI1 from Arabidopsis with 48.89% of identity
• Blastx: Protein XRI1 from Arabidopsis with 47.31% of identity
• Eggnog: NA(ENOG410YGP1)
• Kegg: Link to kegg annotations (AT5G48720)
• CantataDB: Link to cantataDB annotations (CNT0001513)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462505.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;