Transcript | Ll_transcript_499873 |
---|---|
CDS coordinates | 1168-1590 (+) |
Peptide sequence | MQFSPDDLNFSGANDVQFDVAGLNDTAPSSEQNVVQQPVTRTRGNIIVKGRKYFIRTPTKLASYVAYPFAFLKPSGAHGDVTLKEINRRIRTPPPSKSNQSSEDPSAYPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG* |
ORF Type | complete |
Blastp | Protein XRI1 from Arabidopsis with 39.13% of identity |
---|---|
Blastx | Protein XRI1 from Arabidopsis with 56.55% of identity |
Eggnog | NA(ENOG410YGP1) |
Kegg | Link to kegg annotations (AT5G48720) |
CantataDB | Link to cantataDB annotations (CNT0001513) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449093.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer