| Transcript | Ll_transcript_499877 |
|---|---|
| CDS coordinates | 286-597 (+) |
| Peptide sequence | MSYLDNMQKELEEYRETSQVKRRRMLQFNSQDSDHSFSSEEATSAYLKLNVSEKEDSKKDIFPEVSQWMCGAAGNATASGYEDLESTEGWLAECFNDAEMQFSP |
| ORF Type | 3prime_partial |
| Blastp | Protein XRI1 from Arabidopsis with 41.18% of identity |
|---|---|
| Blastx | Protein XRI1 from Arabidopsis with 41.18% of identity |
| Eggnog | NA(ENOG410YGP1) |
| Kegg | Link to kegg annotations (AT5G48720) |
| CantataDB | Link to cantataDB annotations (CNT0001513) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449101.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer