Protein coding transcript 38001

• Transcript: Ll_transcript_500894
• CDS coordinates: 30-518 (+)
• Peptide sequence: MQNSFVHKLVSQTQNHFISQRTIFHNHTHTFRHRVFTSLTKPNTSQQRHHIPNSFFTHPLHPFHSHHSFSTTIPGFLSKPLITRLKTLFHCSSKLPTVFFRRQSFDFNQISNFYQRNWRSWIHRLTPHEVVLGLIGANVAVFLLWRIADENFMTNNFTISLDN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_500894

• Blastp: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 37.06% of identity
• Blastx: RHOMBOID-like protein 12, mitochondrial from Arabidopsis with 37.06% of identity
• Eggnog: rhomboid family(COG0705)
• Kegg: Link to kegg annotations (AT1G18600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463114.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;