Protein coding transcript 38097

• Transcript: Ll_transcript_501625
• CDS coordinates: 1598-2212 (+)
• Peptide sequence: MSDDFQTPVIITGSLQEALKYINTSLKKLKKKMQKRAQLQLIQSLIQVEKEIGEVLDLLGFLSSKSYAKIQSQIEIEKDIAKVLGSLGSIPTNSYAEVLQELKDKALKRADLAEDEVLSLIEERTQARLNKDFPKSDKIRTDLTAKGIALMDVGNETIWRPCIPSEPLAAEVTQKAPIVEEKQSTPTVDKKVEQERNVPQTAST*
• ORF Type: complete

Annotations of Ll_transcript_501625

• Blastp: Cysteine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.47% of identity
• Blastx: Cysteine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.47% of identity
• Eggnog: Cysteinyl-tRNA synthetase(COG0215)
• Kegg: Link to kegg annotations (AT2G31170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453015.1)
• Pfam: tRNA synthetases class I (C) catalytic domain (PF01406.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;