Protein coding transcript 38176

• Transcript: Ll_transcript_499909
• CDS coordinates: 1-558 (+)
• Peptide sequence: PHSSLLALGMDSFSLPILFFLFTIFLAFVSGSRDLAGDVLRLPSTQASRFLHDDNIQGTRWAILFAGSSGYWNYRHQADVCHAYQILRKGGVKEENIIVFMFDDIAFDEENPRPGVIINKPDGDDVYEGVPKDYTGSDVTAHNFYAALLGNKSALTGGSGKVVHSGPNDHIFIYYTDHGGPGILG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_499909

• Blastp: Vacuolar-processing enzyme from Vicia with 75.96% of identity
• Blastx: Vacuolar-processing enzyme from Vicia with 80.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429530.1)
• Pfam: Peptidase C13 family (PF01650.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;