Protein coding transcript 38181

• Transcript: Ll_transcript_499914
• CDS coordinates: 819-1310 (+)
• Peptide sequence: MCLLTRQYMYSPCDIELYIFTGGILRGSRRERLLSKFVENECEKIDRLMELYLRYSDRVKAETERLNEIELDDLEMDEDEKYNRKLESGLYTLQLLAVILGHLWCSEHQQMRGRIELLLRQNKLSKKHIKDILQEYHDNIGDIDGPEEKERAQTKVQKFLMAL*
• ORF Type: complete

Annotations of Ll_transcript_499914

• Blastp: Beta-catenin-like protein 1 from Bos with 36.99% of identity
• Blastx: Beta-catenin-like protein 1 from Bos with 36.36% of identity
• Eggnog: Catenin, beta like 1(ENOG410XPFW)
• Kegg: Link to kegg annotations (282421)
• CantataDB: Link to cantataDB annotations (CNT0000210)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419356.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;