Protein coding transcript 38189

• Transcript: Ll_transcript_499898
• CDS coordinates: 1-453 (+)
• Peptide sequence: PHSSLLALGMDSFSLPILFFLFTIFLAFVSGSRDLAGDVLRLPSTQASRFLHDDNIQGTRWAILFAGSSGYWNYRHQADVCHAYQILRKGGVKEENIIVFMFDDIAFDEENPRPGVIINKPDGDDVYAGVPKVNYLLCFQHSIPYCYFNF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_499898

• Blastp: Vacuolar-processing enzyme from Vicia with 72.31% of identity
• Blastx: Vacuolar-processing enzyme from Vicia with 62.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429530.1)
• Pfam: Peptidase C13 family (PF01650.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;