Protein coding transcript 38196

• Transcript: Ll_transcript_501029
• CDS coordinates: 157-543 (+)
• Peptide sequence: MENGDIPEDANERMHMFPAHSLISGNFPFSCFVYAYEYDSCVFIALTDCPGPQSESAGKSDACDGCPNQQICATAPKGPDPDLVAIAERMATVKHKILVLSGKGGVGKSTFSAQLAFALAAMDFQVGLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_501029

• Blastp: Cytosolic Fe-S cluster assembly factor NBP35 from Arabidopsis with 65.12% of identity
• Blastx: Cytosolic Fe-S cluster assembly factor NBP35 from Arabidopsis with 65.12% of identity
• Eggnog: ATP-binding protein(COG0489)
• Kegg: Link to kegg annotations (AT5G50960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446039.1)
• Pfam: NUBPL iron-transfer P-loop NTPase (PF10609.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;