Protein coding transcript 382

• Transcript: Ll_transcript_317594
• CDS coordinates: 185-568 (+)
• Peptide sequence: MMKRHKVEEGDASNEGDLMNTTNNHSYNESLRSSWIQRKSKDTEIDVRIIDNEVTIKLVQRKKINCLVYASQVLDELNLDLQHVAGGHIGDFSSFMFNSKISEGSSVYASAIANKLIEVMDRNLGAA*
• ORF Type: complete

Annotations of Ll_transcript_317594

• Blastp: Transcription factor bHLH91 from Arabidopsis with 66.67% of identity
• Blastx: Transcription factor bHLH10 from Arabidopsis with 55.37% of identity
• Eggnog: basic helix-loop-helix (bHLH) family protein(ENOG4111NJY)
• Kegg: Link to kegg annotations (AT2G31210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420771.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;