Transcript | Ll_transcript_500395 |
---|---|
CDS coordinates | 1-339 (+) |
Peptide sequence | LQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGVPGKIDLYVGKTVVKRGIAMERATNALIELIKENGRWVDPPTEE* |
ORF Type | 5prime_partial |
Blastp | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Oryza sativa with 91.07% of identity |
---|---|
Blastx | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Oryza sativa with 91.07% of identity |
Eggnog | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity(COG0821) |
Kegg | Link to kegg annotations (4329911) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448725.1) |
Pfam | GcpE protein (PF04551.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer