Protein coding transcript 38282

• Transcript: Ll_transcript_500403
• CDS coordinates: 2-448 (+)
• Peptide sequence: AIGLSTVSAAWGIGLIIGPALGGYLAQPVEKYPHVFSKGSFWEKFPYSLPCFIISGLAFVAAIVCIWIPETLHNHNGGNESTDDDTEALENGSSGSCQDKIVQKNENLLRNWPLMAAILIYSIYALHDIAYQEVFSLWAVSPRRLGGLN
• ORF Type: internal

Annotations of Ll_transcript_500403

• Blastp: Protein ZINC INDUCED FACILITATOR 1 from Arabidopsis with 50.97% of identity
• Blastx: Protein ZINC INDUCED FACILITATOR 1 from Arabidopsis with 45.74% of identity
• Eggnog: Major Facilitator superfamily(ENOG410XSE0)
• Kegg: Link to kegg annotations (AT5G13740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447123.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;