| Transcript | Ll_transcript_500385 |
|---|---|
| CDS coordinates | 1-303 (+) |
| Peptide sequence | LMSAILAYSASALHDVAYQEVFSLWAVSPRRLGGLTFTTDDVGNVLSISGFALIIYQISLYPFVEKAFGSISLARISGLLSIPLLQSYPFIAMLSGLTLFI |
| ORF Type | internal |
| Blastp | Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 54.55% of identity |
|---|---|
| Blastx | Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 54.55% of identity |
| Eggnog | Major Facilitator superfamily(ENOG410XSE0) |
| Kegg | Link to kegg annotations (AT5G13750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019434756.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer