Transcript | Ll_transcript_328755 |
---|---|
CDS coordinates | 171-1124 (+) |
Peptide sequence | MGVSSSSAPEPATPTAQVSAIFIYPIKSCRGISVPSAPLTPTGLRWDRQWVVVNSKGRACTQRVEPGLALIEVQLPSEAFDETWEPTKVSYMVLKAPGMQPLEVCLNKQHGVTDGVSVWEWSGSAWDEGAEASQWFSDYLGKPSRLVRFNTAAEVRPVDPDYVKGHQTMFSDGYPFLLISQESLNALNQLLKEPLPINRFRPNFLVEGCEPFSEDLWQEIDISRFSFLAVKLCSRCKIPSIDQETGISGPEPNETLMRTRSDKVIRPNGKQKSKFYFGQNLVWNWKDSSAKGNGKIINVGDPVFVHKKVSSADEAAA* |
ORF Type | complete |
Blastp | Mitochondrial amidoxime reducing component 2 from Mus with 33.66% of identity |
---|---|
Blastx | Mitochondrial amidoxime-reducing component 1 from Mus with 34.54% of identity |
Eggnog | MOSC domain-containing protein(COG3217) |
Kegg | Link to kegg annotations (67247) |
CantataDB | Link to cantataDB annotations (CNT0001229) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424642.1) |
Pfam | MOSC N-terminal beta barrel domain (PF03476.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer