Protein coding transcript 3840

• Transcript: Ll_transcript_328756
• CDS coordinates: 102-422 (+)
• Peptide sequence: MQPLEVCLNKQHGVTDGVSVWEWSGSAWDEGAEASQWFSDYLGKPSRLVRFNTAAEVRPVDPDYVKGHQTMFSDGYPFLLISQESLNALNQLLKEPLPINRFRPKY*
• ORF Type: complete

Annotations of Ll_transcript_328756

• Blastp: Mitochondrial amidoxime reducing component 2 from Bos with 35% of identity
• Blastx: Mitochondrial amidoxime reducing component 2 from Bos with 31.93% of identity
• Eggnog: MOSC domain-containing protein(COG3217)
• Kegg: Link to kegg annotations (615506)
• CantataDB: Link to cantataDB annotations (CNT0001229)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424642.1)
• Pfam: MOSC N-terminal beta barrel domain (PF03476.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;