Protein coding transcript 38408

• Transcript: Ll_transcript_501132
• CDS coordinates: 172-837 (+)
• Peptide sequence: MALCNEIIGSSFIERSSTRIHLQQKQNLFLGRSGFVPLRNRRVVRLKKVAKFPVAALSTDLVKVSSSSVPVEKPVKFKVRAVVTVRNKINEDLTELLVKRFDAIADNFGNSVGLELLSTDIDPKTRAPKKTNEAVLKGWSTKSNVKAERVDYIAEFVVDSSFGLPGAITVTNRHQQEFFLETITIEGFPNGAVHFPCNSWVQARKDLPGKRIFFSNKVISP*
• ORF Type: complete

Annotations of Ll_transcript_501132

• Blastp: Linoleate 13S-lipoxygenase 3-1, chloroplastic from Solanum with 56.71% of identity
• Blastx: Linoleate 13S-lipoxygenase 3-1, chloroplastic from Solanum with 70.42% of identity
• Eggnog: Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410YN4N)
• Kegg: Link to kegg annotations (102597498)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433919.1)
• Pfam: PLAT/LH2 domain (PF01477.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;