Protein coding transcript 38415

• Transcript: Ll_transcript_501120
• CDS coordinates: 205-1602 (+)
• Peptide sequence: MPLCNEIMGSSLIERSSFISSSKRVLFHHHHSFQEKKNLTLLPLDRRVVRLRKVAKFPVAAISEDLLKGSSSSSSSVPAEKPVKFKVRAVVTVRNKIKEDFKEILVKQLDAIGDSIGRNVVLELFSAEIDPKTNAPKKSNEAVLKDWSKKSNVKAERVNYIAEFSVDSSFGEPGAITVTNKHQQEFFLENITIEGFATGAVHFPCNSWVQARKDHHGKRIFFSNKPYLPSDTPGGLKLLREKELKNVRGDGKGVRKLSDRIYDYDTYNDLGNPDKGIHLRRPTLGASQQYPYPRRCRTGRAPTDRDLYAESRVEKPLPMYVPRDERFEESKKNTFSVKRLKGVLHLLIPSLKSSLSINNQDFNEFSDVDALYTEGLLIKLGLQDDILKKVPLPKLVSKIKESSQGILKYDIPKIITSEYKFCCASLFYVSFYRLLVPEDNLYLPTSKNMTHLPFFLVLEMFFYRK*
• ORF Type: complete

Annotations of Ll_transcript_501120

• Blastp: Lipoxygenase 4, chloroplastic from Arabidopsis with 64.25% of identity
• Blastx: Lipoxygenase 4, chloroplastic from Arabidopsis with 66.67% of identity
• Eggnog: Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410YN4N)
• Kegg: Link to kegg annotations (AT1G72520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425679.1)
• Pfam: PLAT/LH2 domain (PF01477.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;